PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_05768
Common NameKK1_005911
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family SRS
Protein Properties Length: 348aa    MW: 36620.6 Da    PI: 8.4908
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_05768genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702219.57.4e-681332923154
         DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskk 98 
                     gt++CqdCGnqakkdC+ +RCRtCCksrgfdC thvkstWvpaa+rrerq ++aa+++ a +s +++ +k++r    ++q+++s+t++s++++++
  C.cajan_05768 133 GGTTTCQDCGNQAKKDCVNRRCRTCCKSRGFDCPTHVKSTWVPAARRRERQLMTAATAAVAGSSGSTSGTKKPRLI--ASQTTTSHTSTSNTTPPR 226
                    5789***********************************************9999999999999999999999975..9999999*********** PP

         DUF702  99 eletss..........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                    +++tss          lP +v+++avf+cvrv++v+dg++e+aYq++v+igGhvfkG+LydqG+e+
  C.cajan_05768 227 SFDTSSshqdagfkesLPGQVRAPAVFKCVRVTAVEDGQDEYAYQAVVKIGGHVFKGFLYDQGVEN 292
                    ****999********************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051425.4E-62135291IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.9E-27137179IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.8E-29243290IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0048364Biological Processroot development
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MWSGATRSIN YPEMGMFVVA PASSFHHHHQ QIPPPHDPVV ADSLNPATAL GVGVSVIPLL  60
AATPCLESDN ILGNRTRGGG IQFWQEPQPP QPHQGHYMKK QHQDLLNHNN NNSSPGNLLQ  120
NSGGVTGSGT SSGGTTTCQD CGNQAKKDCV NRRCRTCCKS RGFDCPTHVK STWVPAARRR  180
ERQLMTAATA AVAGSSGSTS GTKKPRLIAS QTTTSHTSTS NTTPPRSFDT SSSHQDAGFK  240
ESLPGQVRAP AVFKCVRVTA VEDGQDEYAY QAVVKIGGHV FKGFLYDQGV ENRDVYPNLS  300
ELHLGGGSGS GGSGGRNGVS SSSPMMDPSD VYGGGLLGGS SAYGNPMN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150362e-93AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007141493.11e-178hypothetical protein PHAVU_008G200700g
SwissprotQ94CK92e-84LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLA0A151U1T70.0A0A151U1T7_CAJCA; Uncharacterized protein
STRINGGLYMA02G44860.21e-176(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65043351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.27e-69Lateral root primordium (LRP) protein-related